General Information

  • ID:  hor002902
  • Uniprot ID:  Q9W0W6
  • Protein name:  NPLP1-4
  • Gene name:  Nplp1
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  MTYamide peptide: Expressed in the larval CNS (at protein level). NAP peptide: Expressed in the larval CNS (at protein level). IPNamide peptide: Expressed in the ventral ganglion of the third larval instar and adult brain (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  NLGALKSSPVHGVQQ
  • Length:  15(229-243)
  • Propeptide:  MQAVLQSAHSSRRLMLLLSMLLNAAIQPRSIIVSATDDVANVSPCEMESLINQLMSPSPEYQLHASALRNQLKNLLRERQLAVGEEQPLGEYPDYLEEDKRSVAALAAQGLLNAPKRSLATLAKNGQLPTAEPGEDYGDADSGEPSEQKRYIGSLARAGGLMTYGKRNVGTLARDFQLPIPNGKRNIATMARLQSAPSTHRDPKRNVAAVARYNSQHGHIQRAGAEKRNLGALKSSPVHGVQQKREDEEMLLPAA
  • Signal peptide:  MQAVLQSAHSSRRLMLLLSMLLNAAIQP
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [NPLP1-4]: Acts as a ligand for the receptor-type guanylate cyclase Gyc76C (PubMed:21893139). Stimulates Gyc76c-dependent cGMP production and modulates the IMD innate immune pathway in response to salt stress by inducing nuclear translocation of NF-kappa-
  • Mechanism:  Stimulates Gyc76c-dependent cGMP production and modulates the IMD innate immune pathway in response to salt stress by inducing nuclear translocation of NF-kappa-B protein Rel which leads to increased expression of the antimicrobial peptide diptericin
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9W0W6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002902_AF2.pdbhor002902_ESM.pdb

Physical Information

Mass: 178464 Formula: C66H111N21O21
Absent amino acids: CDEFIMRTWY Common amino acids: GLQSV
pI: 9.7 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -25.33 Boman Index: -1312
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 97.33
Instability Index: 5891.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21893139
  • Title:  The receptor guanylate cyclase Gyc76C and a peptide ligand, NPLP1-VQQ, modulate the innate immune IMD pathway in response to salt stress.
  • PubMed ID:  20575072
  • Title:  Multiple neuropeptides in the Drosophila antennal lobe suggest complex modulatory circuits.